PUMA

academical publication management
collect, organize, and share publications

( en | de )

 

user
  • tag
  • user
  • group
  • author
  • concept
  • BibTeX key
  • search
@bjoernschembera
  •  sign in
  • groups
  • persons
  • University Bibliography
  •  sign in

Login

Login as group.

@

I've lost my password.


Login with ac- oder st-account

sign in
  1. user
  2. @bjoernschembera
  3. Simulation dark

Publication title

bookmarks  (hide)
  • display
  • all
  • bookmarks only
  • bookmarks per page
  • 5
  • 10
  • 20
  • 50
  • 100
  • sort by
  • added at
  • title
  • RSS
  • BibTeX
  • XML

    No matching posts.
  • ⟨⟨
  • ⟨
  • ⟩
  • ⟩⟩

publications  (hide)2  
  • display
  • all
  • publications only
  • publications per page
  • 5
  • 10
  • 20
  • 50
  • 100
  • sort by
  • added at
  • title
  • author
  • publication date
  • entry type
  • help for advanced sorting...
  • BibTeX
  • CSV
  • RDF
  • RSS
  • more...

  •  

     
    2Exploration of core concepts required for mid-and domain-level ontology development to facilitate explainable-AI-readiness of data and models
     

    M. Horsch, S. Chiacchiera, I. Todorov, A. Correia, A. Dey, N. Konchakova, S. Scholze, S. Stephan, K. Tøndel, A. Sarkar and 3 other author(s). (2024)
    10 months ago by @bjoernschembera
    show all tags
    • cmcs
    • dark
    • data
    • fair
    • hpc
    • mathematik
    • metadata
    • myown
    • simulation
    • xair
     
      cmcsdarkdatafairhpcmathematikmetadatamyownsimulationxair
      copydeleteadd this publication to your clipboard
      • community post
      • history of this post
      • URL
      • DOI
      • BibTeX
      • EndNote
      • APA
      • Chicago
      • DIN 1505
      • Harvard
      • MSOffice XML
       
       
    •  

       
      3Forschungsdatenmanagement im Kontext dunkler Daten in den Simulationswissenschaften
       

      B. Schembera. Universität Stuttgart, Stuttgart, Publication, (2019)
      5 years ago by @bjoernschembera
      show all tags
      • dark
      • data
      • hpc
      • metadata
      • myown
      • simulation
       
        darkdatahpcmetadatamyownsimulation
        copydeleteadd this publication to your clipboard
        • community post
        • history of this post
        • URL
        • DOI
        • BibTeX
        • EndNote
        • APA
        • Chicago
        • DIN 1505
        • Harvard
        • MSOffice XML
         
         
      • ⟨⟨
      • ⟨
      • 1
      • ⟩
      • ⟩⟩

      browse

      • Simulation dark as tag from all users

      related tags

      • + | data
      • + | hpc
      • + | metadata
      • + | myown
      • + | cmcs
      • + | fair
      • + | mathematik
      • + | xair

      concepts

      tags

      • myown
      • metadata
      • data
      • hpc
      • simulation
      • cmcs
      • rdm
      • mathematik
      • distributed
      • nfdi
      • ians
      • ontologies
      • hlrs
      • nfdi4cat
      • interoperability
      • dark
      • knowledge
      • "dark
      • data"
      • privacy
      • semantics
      • archiving
      • catalysis
      • service
      • obfuscation
      • simtech
      • computer
      • information
      • crawling
      • ontology
      • ontoloties
      • management
      • philosophie
      • "data
      • management"
      • philosophy
      • systems
      • "research
      • dikw
      • mardi
      • technik
      • Computersimulation
      • math
      • technikphilosophie
      • DH
      • energy
      What is PUMA?
      Getting Started
      Browser Buttons
      Help
      Contact & Privacy
      Impressum
      Privacy & Terms of Use
      Cookies
      Report Issues
      Integration
      PUMA
      TYPO3 Extension
      WordPress Plugin
      Java REST Client
      Supported Sites
      more
      About PUMA
      Background
      Blog
      Social Media
       Facebook

      PUMA is offered by Universitätsbibliothek Stuttgart.